PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla013687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB
Protein Properties Length: 224aa    MW: 25179.1 Da    PI: 7.962
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla013687genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73.1e-09750344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT  Ed+l+ +a    + +   +W ++a +++ g+++ ++k+++
        Cla013687  7 QWTRSEDKLFEEALVVVPANlpdRWQRVADHVP-GKSPREVKDHY 50
                     6*****************99*************.**********9 PP

2Myb_DNA-binding44.53.6e-14106150347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
        Cla013687 106 PWTEEEHRLFLLGLKKFGKGDWRSISRNVVITRTPTQVASHAQKY 150
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.12158IPR017930Myb domain
SMARTSM007175.4E-8456IPR001005SANT/Myb domain
SuperFamilySSF466895.23E-12662IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-6653IPR009057Homeodomain-like
PfamPF002499.0E-8751IPR001005SANT/Myb domain
CDDcd001671.82E-8854No hitNo description
PROSITE profilePS5129420.74899155IPR017930Myb domain
SuperFamilySSF466891.08E-16101155IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17102154IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-11103149IPR009057Homeodomain-like
SMARTSM007171.6E-12103153IPR001005SANT/Myb domain
PfamPF002499.7E-13106150IPR001005SANT/Myb domain
CDDcd001673.23E-11106151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MTQSSTQWTR SEDKLFEEAL VVVPANLPDR WQRVADHVPG KSPREVKDHY EALVHDVLEI  60
DSGRVELPSY ADESAVGLPE WDSSGQISFG SKAKPGGDNE RKKGTPWTEE EHRLFLLGLK  120
KFGKGDWRSI SRNVVITRTP TQVASHAQKY FLRQTSGKKE RKRSSIHDIT TVDNNSIPMP  180
IDPNWISPAP NNPTVQSSMQ QLSPTGHVPD QGGSFGFQNY RFPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-158701173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818211e-157LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132571e-157LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140910.11e-159PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KE731e-159A0A0A0KE73_CUCSA; Syringolide-induced protein 1-3-1B
STRINGGLYMA20G24600.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.17e-72MYB family protein